PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo17G0042900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 486aa    MW: 54427.4 Da    PI: 7.2527
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo17G0042900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.6e-19141187148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde+++++++++G++ W+ Ia+ m  gR +kqc++rw+++l
  Spipo17G0042900 141 KGAWTKEEDERIIELINKYGTKKWSIIASGMR-GRIGKQCRERWHNHL 187
                      79******************************.*************97 PP

2Myb_DNA-binding59.76.4e-19193235145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g+WTteE++ l++a++++G++ W+ I++ ++ gRt++++k++w+
  Spipo17G0042900 193 KGAWTTEEELMLIRAHQMYGNK-WAEISKLLP-GRTDNSIKNHWN 235
                      79********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.1778135IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-10118147IPR009057Homeodomain-like
PROSITE profilePS5129430.701136191IPR017930Myb domain
SuperFamilySSF466897.11E-32138234IPR009057Homeodomain-like
SMARTSM007171.8E-17140189IPR001005SANT/Myb domain
PfamPF002492.2E-17141187IPR001005SANT/Myb domain
CDDcd001671.44E-14143187No hitNo description
Gene3DG3DSA:1.10.10.602.0E-25148194IPR009057Homeodomain-like
SMARTSM007176.7E-18192240IPR001005SANT/Myb domain
PROSITE profilePS5129422.068192242IPR017930Myb domain
PfamPF002491.9E-17193235IPR001005SANT/Myb domain
CDDcd001672.08E-12195235No hitNo description
Gene3DG3DSA:1.10.10.601.6E-24195242IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MSERRLRESR SSHVAENDGL SQRSSPDSLD DFSCLFGNLQ AVVNGRIISR FVGPGIREWA  60
FVLVFRTMEV KWLQVQPEER TEVMGRVKKE EFDEDAETEE WSYEEIIKGR LDGRGTESFQ  120
GRTDVQCLHR WHKVLNPELI KGAWTKEEDE RIIELINKYG TKKWSIIASG MRGRIGKQCR  180
ERWHNHLNPG IKKGAWTTEE ELMLIRAHQM YGNKWAEISK LLPGRTDNSI KNHWNCSVKK  240
KLDSYLSSGL LVQEPEISYA LNLNGTAPAA AIKSPTAFGR STTLETPGSE EISRHLEADE  300
HDSGRPLPSS GAMLRRKSSS RVDFSFCVTV DRPTPLESSR SWEVEMPGSA APLTTEEASA  360
YSCEPDCHRQ TRASAMVDPK PCASGREDSP FQMERPAPTA AAASKNSSSS SPPSPSCEYE  420
EEDKYFRLQL QESLLDSLAI MPDLSAPANL LQGISLNLKM SPRSILGAAA RSFKNIPSIL  480
GKRRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-581012429159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-581012429159MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.26e-71myb domain protein 3r-4